Lineage for d6ck7d1 (6ck7 D:1-170)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606866Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 2606867Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 2607053Family d.167.1.0: automated matches [191587] (1 protein)
    not a true family
  6. 2607054Protein automated matches [191055] (20 species)
    not a true protein
  7. 2607110Species Legionella pneumophila [TaxId:446] [350187] (1 PDB entry)
  8. 2607114Domain d6ck7d1: 6ck7 D:1-170 [350292]
    Other proteins in same PDB: d6ck7a2, d6ck7b2, d6ck7c2, d6ck7d2
    automated match to d3qu1a_
    complexed with bb2, so4, zn

Details for d6ck7d1

PDB Entry: 6ck7 (more details), 1.65 Å

PDB Description: crystal structure of a peptide deformylase from legionella pneumophila bound to actinonin
PDB Compounds: (D:) Peptide deformylase

SCOPe Domain Sequences for d6ck7d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ck7d1 d.167.1.0 (D:1-170) automated matches {Legionella pneumophila [TaxId: 446]}
mairkilylpderlrkiakpvetfdeslqtlindmfdtmydargvglaapqigvslrlsv
idivgdkkeqivivnpeivsshgekefeegclsvpgaydtvvraekvtvkaldrfgkpfe
itgegllaeclqheidhmngklfvdmlsplkrmmarrkldkfkrlqarkp

SCOPe Domain Coordinates for d6ck7d1:

Click to download the PDB-style file with coordinates for d6ck7d1.
(The format of our PDB-style files is described here.)

Timeline for d6ck7d1: