SCOPe 2.07: Domain d6c0ea_: 6c0e A:

Lineage for d6c0ea_ (6c0e A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.0: automated matches [191423] (1 protein)
   not a true family

6. Protein automated matches [190603] (24 species)
   not a true protein

7. Species Legionella pneumophila [TaxId:272624] [350221] (2 PDB entries)

8. Domain d6c0ea_: 6c0e A: [350245]
   automated match to d2iv0a_
   complexed with cl, ee1, gly

Details for d6c0ea_

PDB Entry: 6c0e, 1.7 Å

PDB Description: crystal structure of isocitrate dehydrogenase from legionella pneumophila with bound nadph with an alpha-ketoglutarate adduct

PDB Compounds: (A:) isocitrate dehydrogenase

SCOPe Domain Sequences for d6c0ea_:

Sequence; same for both SEQRES and ATOM records:

>d6c0ea_ c.77.1.0 (A:) automated matches {Legionella pneumophila [TaxId: 272624]}
smtydkikvpaqgeaitvaadhslhvpdnpiipfiegdgigvdvtppmirvvdaavqkay
gnkrkiswmevyagekatkvyggdqwlpketldamkkyvvsikgplttpvgggirslnva
irqdmdlyvclrpiryfngvpspvrepwktdmvifrensediyagiewqadtpeakkviq
fltkemgvkkirfpehcgigvkpvsregttrlvkaaiqyaidndrstvtlvhkgnimkft
egafkdwgyqvardsfgakeyqggpwmefknpktgkqiiindviadaflqqillrpedys
viatlnlngdyisdalaaqvggigiapganisdqmavfeathgtapkyagqnkvnpgsii
lsaemmlrhmgwyeaadliirgmegaieaktvtydfergmqgatlvsssgfadamikhm

Timeline for d6c0ea_:

• d6c0ea_ is new in SCOPe 2.07-stable
  
• d6c0ea_ appears in the current release, SCOPe 2.08