Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) the constituent families form similar dimers |
Family c.77.1.0: automated matches [191423] (1 protein) not a true family |
Protein automated matches [190603] (24 species) not a true protein |
Species Legionella pneumophila [TaxId:272624] [350221] (2 PDB entries) |
Domain d6c0ea_: 6c0e A: [350245] automated match to d2iv0a_ complexed with cl, ee1, gly |
PDB Entry: 6c0e (more details), 1.7 Å
SCOPe Domain Sequences for d6c0ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6c0ea_ c.77.1.0 (A:) automated matches {Legionella pneumophila [TaxId: 272624]} smtydkikvpaqgeaitvaadhslhvpdnpiipfiegdgigvdvtppmirvvdaavqkay gnkrkiswmevyagekatkvyggdqwlpketldamkkyvvsikgplttpvgggirslnva irqdmdlyvclrpiryfngvpspvrepwktdmvifrensediyagiewqadtpeakkviq fltkemgvkkirfpehcgigvkpvsregttrlvkaaiqyaidndrstvtlvhkgnimkft egafkdwgyqvardsfgakeyqggpwmefknpktgkqiiindviadaflqqillrpedys viatlnlngdyisdalaaqvggigiapganisdqmavfeathgtapkyagqnkvnpgsii lsaemmlrhmgwyeaadliirgmegaieaktvtydfergmqgatlvsssgfadamikhm
Timeline for d6c0ea_: