SCOPe 2.07: Domain d6be3l2: 6be3 L:113-213

Lineage for d6be3l2 (6be3 L:113-213)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6be3l2: 6be3 L:113-213 [350110]
   automated match to d4k3dl2
   complexed with nag

Details for d6be3l2

PDB Entry: 6be3, 1.6 Å

PDB Description: crystal structure of a polysaccharide-binding human fab (f598) in complex with n-acetyl-d-glucosamine (glcnac)

PDB Compounds: (L:) Fab (F598) Light Chain

SCOPe Domain Sequences for d6be3l2:

Sequence; same for both SEQRES and ATOM records:

>d6be3l2 b.1.1.0 (L:113-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap

Timeline for d6be3l2:

• d6be3l2 is new in SCOPe 2.07-stable
  
• d6be3l2 appears in the current release, SCOPe 2.08