Lineage for d6cdqb2 (6cdq B:441-748)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2333057Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2333058Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2333804Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2333805Protein automated matches [191104] (14 species)
    not a true protein
  7. 2333823Species Burkholderia pseudomallei [TaxId:320372] [350085] (5 PDB entries)
  8. 2333839Domain d6cdqb2: 6cdq B:441-748 [350106]
    automated match to d2ccda2
    complexed with cl, hem, mpd, na, niz, oxy, po4

Details for d6cdqb2

PDB Entry: 6cdq (more details), 1.92 Å

PDB Description: crystal structure of the w202f variant of catalase-peroxidase from b. pseudomallei with inh bound.
PDB Compounds: (B:) Catalase-peroxidase

SCOPe Domain Sequences for d6cdqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cdqb2 a.93.1.0 (B:441-748) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
aevllwqdpipavdhplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrgga
ngarirlapqkdweanqpeqlaavletleairtafngaqrggkqvsladlivlagcagve
qaaknaghavtvpfapgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdk
aqlltlsapemtvllgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaa
dadvfegrdratgelkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvm
nldrfdla

SCOPe Domain Coordinates for d6cdqb2:

Click to download the PDB-style file with coordinates for d6cdqb2.
(The format of our PDB-style files is described here.)

Timeline for d6cdqb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6cdqb1