SCOPe 2.07: Domain d6cbjl2: 6cbj L:112-213

Lineage for d6cbjl2 (6cbj L:112-213)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d6cbjl2: 6cbj L:112-213 [350093]
   Other proteins in same PDB: d6cbjl1
   automated match to d2fb4l2
   complexed with bma, man, nag, po4

Details for d6cbjl2

PDB Entry: 6cbj, 2.85 Å

PDB Description: crystal structure of dh270.3 fab in complex with man9

PDB Compounds: (L:) DH270.3 Fab light chain

SCOPe Domain Sequences for d6cbjl2:

Sequence; same for both SEQRES and ATOM records:

>d6cbjl2 b.1.1.2 (L:112-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkgapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

Timeline for d6cbjl2:

• d6cbjl2 is new in SCOPe 2.07-stable
  
• d6cbjl2 appears in the current release, SCOPe 2.08