SCOPe 2.07: Domain d6c46b1: 6c46 B:1-181

Lineage for d6c46b1 (6c46 B:1-181)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.0: automated matches [191354] (1 protein)
   not a true family

6. Protein automated matches [190388] (31 species)
   not a true protein

7. Species Elizabethkingia anophelis [TaxId:1338011] [350033] (1 PDB entry)

8. Domain d6c46b1: 6c46 B:1-181 [350034]
   Other proteins in same PDB: d6c46a2, d6c46b2, d6c46c2, d6c46d2, d6c46e2
   automated match to d2ixka_
   complexed with ca

Details for d6c46b1

PDB Entry: 6c46, 1.95 Å

PDB Description: crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase from elizabethkingia anophelis nuhp1

PDB Compounds: (B:) dtdp-4-dehydrorhamnose 3,5-epimerase

SCOPe Domain Sequences for d6c46b1:

Sequence; same for both SEQRES and ATOM records:

>d6c46b1 b.82.1.0 (B:1-181) automated matches {Elizabethkingia anophelis [TaxId: 1338011]}
mklvktplkdcyiieptvfedergyfyekynekkfeeltglnghfvqdniskssygvlrg
lhlqkgkhaqaklvsclegrvwdvavdlrensetfgkcygmelsaenklqfyvprgfahg
fvvlsetavfsykcdnfynkesegsvkfndsdlsidwkipeadmilsekdqnapafkdkn
y

Timeline for d6c46b1:

• d6c46b1 is new in SCOPe 2.07-stable
  
• d6c46b1 appears in the current release, SCOPe 2.08