Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.88: SRF-like [55454] (1 superfamily) alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet |
Superfamily d.88.1: SRF-like [55455] (1 family) |
Family d.88.1.1: SRF-like [55456] (5 proteins) |
Protein Myocyte enhancer factor Mef2b core [103117] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [103118] (3 PDB entries) Uniprot Q02080 2-91 |
Domain d6c9lc_: 6c9l C: [350017] automated match to d1tqep_ |
PDB Entry: 6c9l (more details), 2.3 Å
SCOPe Domain Sequences for d6c9lc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6c9lc_ d.88.1.1 (C:) Myocyte enhancer factor Mef2b core {Human (Homo sapiens) [TaxId: 9606]} kiqisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyastdmdr vllkyteysephesrtntdiletlk
Timeline for d6c9lc_: