SCOPe 2.07: Domain d6c6be_: 6c6b E:

Lineage for d6c6be_ (6c6b E:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.4: Adenosine-5'phosphosulfate kinase (APS kinase) [52572] (2 proteins)
   automatically mapped to Pfam PF01583

6. Protein automated matches [226942] (4 species)
   not a true protein

7. Species Cryptococcus neoformans [TaxId:235443] [349971] (1 PDB entry)

8. Domain d6c6be_: 6c6b E: [349972]
   automated match to d1m7ga_
   complexed with adp, edo

Details for d6c6be_

PDB Entry: 6c6b, 2 Å

PDB Description: co-crystal structure of adenylyl-sulfate kinase from cryptococcus neoformans bound to adp

PDB Compounds: (E:) Adenylyl-sulfate kinase

SCOPe Domain Sequences for d6c6be_:

Sequence, based on SEQRES records:

>d6c6be_ c.37.1.4 (E:) automated matches {Cryptococcus neoformans [TaxId: 235443]}
hpgavtqderdtllgqkgctvwltglsasgkstiataleqhllhkklhayrldgdnirfg
lnkdlgfdqasrvenirrigevsllfalsstisvtafispyisdrqlarelhekhssaip
fievfidaplsvveqrdpkglykkarageikdftgisapyeapanpeihirtdevdvaga
veiitkyladnglip

Sequence, based on observed residues (ATOM records):

>d6c6be_ c.37.1.4 (E:) automated matches {Cryptococcus neoformans [TaxId: 235443]}
hpgavtqderdtllgqkgctvwltglsasgkstiataleqhllhkklhayrldgdnirfg
lnkdlgfdqasrvenirrigevsllfalsstisvtafispyisdrqlarelhekhssaip
fievfidaplsvveqrdpkglykkaeikdftgisapyeapanpeihirtdevdvagavei
itkyladnglip

Timeline for d6c6be_:

• d6c6be_ is new in SCOPe 2.07-stable
  
• d6c6be_ appears in the current release, SCOPe 2.08