SCOPe 2.07: Domain d6bp2l2: 6bp2 L:113-216

Lineage for d6bp2l2 (6bp2 L:113-216)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d6bp2l2: 6bp2 L:113-216 [349965]
   Other proteins in same PDB: d6bp2l1
   automated match to d3n9gl2
   complexed with bma, man, nag

Details for d6bp2l2

PDB Entry: 6bp2, 3.17 Å

PDB Description: therapeutic human monoclonal antibody mr191 bound to a marburgvirus glycoprotein

PDB Compounds: (L:) MR191 Fab Light Chain

SCOPe Domain Sequences for d6bp2l2:

Sequence; same for both SEQRES and ATOM records:

>d6bp2l2 b.1.1.2 (L:113-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspikagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptec

Timeline for d6bp2l2:

• d6bp2l2 is new in SCOPe 2.07-stable
  
• d6bp2l2 appears in the current release, SCOPe 2.08