SCOPe 2.08: Domain d6bnlh2: 6bnl H:119-247

Lineage for d6bnlh2 (6bnl H:119-247)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d6bnlh2: 6bnl H:119-247 [349896]
   Other proteins in same PDB: d6bnla1, d6bnlb_, d6bnlc2, d6bnle1, d6bnlf_, d6bnlg2
   automated match to d3q5ya2
   complexed with nag, qwv

Details for d6bnlh2

PDB Entry: 6bnl, 2.6 Å

PDB Description: crystal structure of tcr-mhc-like molecule

PDB Compounds: (H:) NKT Vbeta8.2 (MOUSE) - 2C12 TCR - hybrid mouse variable and human constant domains

SCOPe Domain Sequences for d6bnlh2:

Sequence; same for both SEQRES and ATOM records:

>d6bnlh2 b.1.1.0 (H:119-247) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d6bnlh2:

• d6bnlh2 first appeared in SCOPe 2.07