Lineage for d6byba1 (6byb A:204-313)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394116Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2394399Family b.34.9.0: automated matches [191625] (1 protein)
    not a true family
  6. 2394400Protein automated matches [191144] (3 species)
    not a true protein
  7. 2394415Species Human (Homo sapiens) [TaxId:9606] [189286] (22 PDB entries)
  8. 2394450Domain d6byba1: 6byb A:204-313 [349857]
    automated match to d1oz2a1
    complexed with ec7, edo, unx

Details for d6byba1

PDB Entry: 6byb (more details), 1.74 Å

PDB Description: crystal structure of l3mbtl1 mbt domain with mbk14970
PDB Compounds: (A:) Lethal(3)malignant brain tumor-like protein 1

SCOPe Domain Sequences for d6byba1:

Sequence, based on SEQRES records: (download)

>d6byba1 b.34.9.0 (A:204-313) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ecwswesyleeqkaitapvslfqdsqavthnkngfklgmklegidpqhpsmyfiltvaev
cgyrlrlhfdgysechdfwvnanspdihpagwfektghklqppkgykeee

Sequence, based on observed residues (ATOM records): (download)

>d6byba1 b.34.9.0 (A:204-313) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ecwswesyleeqkaitapvslfqdsqavthnkngfklgmklegidpqhpsmyfiltvaev
cgyrlrlhfdgysechdfwvnanspdihpagwfektghklqppkgye

SCOPe Domain Coordinates for d6byba1:

Click to download the PDB-style file with coordinates for d6byba1.
(The format of our PDB-style files is described here.)

Timeline for d6byba1: