SCOPe 2.07: Domain d6bi0m2: 6bi0 M:108-214

Lineage for d6bi0m2 (6bi0 M:108-214)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6bi0m2: 6bi0 M:108-214 [349813]
   automated match to d4jg1l2
   complexed with edo; mutant

Details for d6bi0m2

PDB Entry: 6bi0, 2.06 Å

PDB Description: trastuzumab fab n158a, d185a, k190a (light chain) triple mutant.

PDB Compounds: (M:) Trastuzumab anti-HER2 Fab Light Chain

SCOPe Domain Sequences for d6bi0m2:

Sequence; same for both SEQRES and ATOM records:

>d6bi0m2 b.1.1.0 (M:108-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgasqesvteqd
skdstyslsstltlskaayekhavyacevthqglsspvtksfnrgec

Timeline for d6bi0m2:

• d6bi0m2 is new in SCOPe 2.07-stable
  
• d6bi0m2 appears in the current release, SCOPe 2.08