SCOPe 2.07: Domain d6bjoa_: 6bjo A:

Lineage for d6bjoa_ (6bjo A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (105 PDB entries)

8. Domain d6bjoa_: 6bjo A: [349686]
   automated match to d1t2ma1
   complexed with duy

Details for d6bjoa_

PDB Entry: 6bjo, 1.75 Å

PDB Description: pick1 pdz domain in complex with the small molecule inhibitor bio124.

PDB Compounds: (A:) PRKCA-binding protein

SCOPe Domain Sequences for d6bjoa_:

Sequence; same for both SEQRES and ATOM records:

>d6bjoa_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpgkvtlqkdaqnligisigggaqycpclyivqvfdntpaaldgtvaagdeitgvngrsi
kgktkvevakmiqevkgevtihynkl

Timeline for d6bjoa_:

• d6bjoa_ is new in SCOPe 2.07-stable
  
• d6bjoa_ appears in the current release, SCOPe 2.08