Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein Influenza hemagglutinin (stalk) [58066] (17 species) trimer |
Species Influenza A virus (strain a/northern territory/60/1968 h3n2) [TaxId:384505] [327816] (3 PDB entries) |
Domain d6bkmb_: 6bkm B: [349645] Other proteins in same PDB: d6bkma1, d6bkma2, d6bkmc1, d6bkmc2, d6bkme1, d6bkme2 automated match to d1qfub_ complexed with bma, man, nag, tam; mutant |
PDB Entry: 6bkm (more details), 2.2 Å
SCOPe Domain Sequences for d6bkmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bkmb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus (strain a/northern territory/60/1968 h3n2) [TaxId: 384505]} glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq
Timeline for d6bkmb_: