Lineage for d6bbza_ (6bbz A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2530622Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest
  4. 2530623Superfamily c.140.1: TTHA0583/YokD-like [110710] (3 families) (S)
  5. 2530639Family c.140.1.0: automated matches [191555] (1 protein)
    not a true family
  6. 2530640Protein automated matches [190957] (7 species)
    not a true protein
  7. 2530663Species Enterobacter cloacae [TaxId:550] [349492] (13 PDB entries)
  8. 2530670Domain d6bbza_: 6bbz A: [349571]
    automated match to d5ht0c_
    complexed with mg, sis

Details for d6bbza_

PDB Entry: 6bbz (more details), 1.9 Å

PDB Description: room temperature neutron/x-ray structure of sisomicin bound aac-via
PDB Compounds: (A:) AAC 3-VI protein

SCOPe Domain Sequences for d6bbza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bbza_ c.140.1.0 (A:) automated matches {Enterobacter cloacae [TaxId: 550]}
tpwskselvrqlrdlgvrsgdmvmphvslravgpladgpqtlvdalieavgptgnilafv
swrdspyeqtlghdappaaiaqswpafdpdhapaypgfgainefirtypgcrrtahpdas
maaigpdaawlvaphemgaaygprspiarflahagkilsigagpdavtalhyaeavarie
gkrrvtysmpllregkrvwvttsdwdsngildeyaapdgpdaveriardylartrvaqgp
vggaqsrlidaadivsfgiewlearha

SCOPe Domain Coordinates for d6bbza_:

Click to download the PDB-style file with coordinates for d6bbza_.
(The format of our PDB-style files is described here.)

Timeline for d6bbza_: