Lineage for d6bdfq_ (6bdf Q:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2594884Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2597144Species Thermoplasma acidophilum [TaxId:2303] [56256] (4 PDB entries)
  8. 2597154Domain d6bdfq_: 6bdf Q: [349545]
    Other proteins in same PDB: d6bdf1_, d6bdfb_, d6bdfd_, d6bdff_, d6bdfh_, d6bdfj_, d6bdfl_, d6bdfn_, d6bdfp_, d6bdfr_, d6bdft_, d6bdfv_, d6bdfx_, d6bdfz_
    automated match to d1pmaa_

Details for d6bdfq_

PDB Entry: 6bdf (more details), 2.8 Å

PDB Description: 2.8 a resolution reconstruction of the thermoplasma acidophilum 20s proteasome using cryo-electron microscopy
PDB Compounds: (Q:) Proteasome subunit alpha

SCOPe Domain Sequences for d6bdfq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bdfq_ d.153.1.4 (Q:) Proteasome alpha subunit (non-catalytic) {Thermoplasma acidophilum [TaxId: 2303]}
tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
gikalkssleegeelkapeiasitvgnkyriydqeevkkfl

SCOPe Domain Coordinates for d6bdfq_:

Click to download the PDB-style file with coordinates for d6bdfq_.
(The format of our PDB-style files is described here.)

Timeline for d6bdfq_: