SCOPe 2.07: Domain d5z0tb3: 5z0t B:555-637

Lineage for d5z0tb3 (5z0t B:555-637)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (41 species)
   not a true protein

7. Species Thermoactinomyces vulgaris [TaxId:2026] [254921] (8 PDB entries)

8. Domain d5z0tb3: 5z0t B:555-637 [349351]
   Other proteins in same PDB: d5z0ta1, d5z0ta2, d5z0tb1, d5z0tb2
   automated match to d1uh4a2
   complexed with ca, mpd; mutant

Details for d5z0tb3

PDB Entry: 5z0t, 1.5 Å

PDB Description: thermoactinomyces vulgaris r-47 alpha-amylase i (tva i) mutant a357v/q359n/y360e (aqy/vne)

PDB Compounds: (B:) Neopullulanase 1

SCOPe Domain Sequences for d5z0tb3:

Sequence; same for both SEQRES and ATOM records:

>d5z0tb3 b.71.1.0 (B:555-637) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
sfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqlsmpngstvtdkitgh
sytvqngmvtvavdghygavlaq

Timeline for d5z0tb3:

• d5z0tb3 is new in SCOPe 2.07-stable
  
• d5z0tb3 appears in the current release, SCOPe 2.08