Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
Protein Adenine PRTase [53288] (5 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69541] (4 PDB entries) |
Domain d5vjpb1: 5vjp B:3-179 [349323] Other proteins in same PDB: d5vjpa2, d5vjpb2 automated match to d1g2qa_ complexed with ade, edo, ir9 |
PDB Entry: 5vjp (more details), 1.98 Å
SCOPe Domain Sequences for d5vjpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vjpb1 c.61.1.1 (B:3-179) Adenine PRTase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} iasyaqelklalhqypnfpsegilfedflpifrnpglfqklidafklhleeafpevkidy ivglesrgflfgptlalalgvgfvpvrkagklpgecfkatyekeygsdlfeiqknaipag snviivddiiatggsaaaagelveqleanlleynfvmeldflkgrsklnapvftlln
Timeline for d5vjpb1: