Lineage for d5vjpb1 (5vjp B:3-179)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2499119Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2499120Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2499121Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2499122Protein Adenine PRTase [53288] (5 species)
  7. 2499123Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69541] (4 PDB entries)
  8. 2499130Domain d5vjpb1: 5vjp B:3-179 [349323]
    Other proteins in same PDB: d5vjpa2, d5vjpb2
    automated match to d1g2qa_
    complexed with ade, edo, ir9

Details for d5vjpb1

PDB Entry: 5vjp (more details), 1.98 Å

PDB Description: crystal structure of adenine phosphoribosyltransferase from saccharomyces cerevisiae complexed with l-2,5-dideoxy-2,5-imino- altritol 1,6-bisphosphate (l-diab) and adenine
PDB Compounds: (B:) adenine phosphoribosyltransferase 1

SCOPe Domain Sequences for d5vjpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vjpb1 c.61.1.1 (B:3-179) Adenine PRTase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
iasyaqelklalhqypnfpsegilfedflpifrnpglfqklidafklhleeafpevkidy
ivglesrgflfgptlalalgvgfvpvrkagklpgecfkatyekeygsdlfeiqknaipag
snviivddiiatggsaaaagelveqleanlleynfvmeldflkgrsklnapvftlln

SCOPe Domain Coordinates for d5vjpb1:

Click to download the PDB-style file with coordinates for d5vjpb1.
(The format of our PDB-style files is described here.)

Timeline for d5vjpb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5vjpb2