Class a: All alpha proteins [46456] (289 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (46 species) not a true protein |
Species Pyrobaculum calidifontis [TaxId:410359] [236095] (4 PDB entries) |
Domain d5xvha2: 5xvh A:162-283 [349287] Other proteins in same PDB: d5xvha1, d5xvha3 automated match to d3ws7a2 complexed with acy, nap, so4, tla |
PDB Entry: 5xvh (more details), 1.57 Å
SCOPe Domain Sequences for d5xvha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xvha2 a.100.1.0 (A:162-283) automated matches {Pyrobaculum calidifontis [TaxId: 410359]} pvgygqamklvnqvvvalntvamveglklakalgldmdkvaevltrgaarsgaielylpk llkgdlspgfkaehlkkdlgyvleearkrgvklpgaelayelyrkmvedgagslgihalg fy
Timeline for d5xvha2: