Lineage for d5xvha2 (5xvh A:162-283)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334421Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2334422Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2334631Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2334632Protein automated matches [226851] (46 species)
    not a true protein
  7. 2335005Species Pyrobaculum calidifontis [TaxId:410359] [236095] (4 PDB entries)
  8. 2335008Domain d5xvha2: 5xvh A:162-283 [349287]
    Other proteins in same PDB: d5xvha1, d5xvha3
    automated match to d3ws7a2
    complexed with acy, nap, so4, tla

Details for d5xvha2

PDB Entry: 5xvh (more details), 1.57 Å

PDB Description: crystal structure of the nadp+ and tartrate-bound complex of l-serine 3-dehydrogenase from the hyperthermophilic archaeon pyrobaculum calidifontis
PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, NAD-binding protein

SCOPe Domain Sequences for d5xvha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xvha2 a.100.1.0 (A:162-283) automated matches {Pyrobaculum calidifontis [TaxId: 410359]}
pvgygqamklvnqvvvalntvamveglklakalgldmdkvaevltrgaarsgaielylpk
llkgdlspgfkaehlkkdlgyvleearkrgvklpgaelayelyrkmvedgagslgihalg
fy

SCOPe Domain Coordinates for d5xvha2:

Click to download the PDB-style file with coordinates for d5xvha2.
(The format of our PDB-style files is described here.)

Timeline for d5xvha2: