Class g: Small proteins [56992] (98 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) |
Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins) |
Protein automated matches [197331] (11 species) not a true protein |
Species Mesobuthus martensii [TaxId:34649] [255319] (5 PDB entries) |
Domain d6aupj1: 6aup J:1-36 [349227] Other proteins in same PDB: d6aupa2, d6aupb2, d6aupc2, d6aupd2, d6aupe2, d6aupf2, d6aupg2, d6auph2, d6aupi2, d6aupj2, d6aupk2, d6aupl2, d6aupm2, d6aupn2, d6aupo2, d6aupp2 automated match to d1j5ja_ complexed with gol, so4 |
PDB Entry: 6aup (more details), 1.95 Å
SCOPe Domain Sequences for d6aupj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6aupj1 g.3.7.2 (J:1-36) automated matches {Mesobuthus martensii [TaxId: 34649]} rptdikcsasyqcfpvcksrfgktngrcvnglcdcf
Timeline for d6aupj1:
View in 3D Domains from other chains: (mouse over for more information) d6aupa1, d6aupa2, d6aupb1, d6aupb2, d6aupc1, d6aupc2, d6aupd1, d6aupd2, d6aupe1, d6aupe2, d6aupf1, d6aupf2, d6aupg1, d6aupg2, d6auph1, d6auph2, d6aupi1, d6aupi2, d6aupk1, d6aupk2, d6aupl1, d6aupl2, d6aupm1, d6aupm2, d6aupn1, d6aupn2, d6aupo1, d6aupo2, d6aupp1, d6aupp2 |