Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (124 species) not a true protein |
Species Anopheles gambiae [TaxId:7165] [348788] (3 PDB entries) |
Domain d6aryb_: 6ary B: [349160] automated match to d1maac_ complexed with bt7, cl, flc, nag; mutant |
PDB Entry: 6ary (more details), 2.26 Å
SCOPe Domain Sequences for d6aryb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6aryb_ c.69.1.0 (B:) automated matches {Anopheles gambiae [TaxId: 7165]} ndplvvntdkgrirgitvdapsgkkvdvwlgipyaqppvgplrfrhprpaekwtgvlntt tppnscvqivdtvfgdfpgatmwnpntplsedclyinvvaprprpknaavmlwifggsfy sgtatldvydhralaseenvivvslqyrvaslgflflgtpeapgnaglfdqnlalrwvrd nihrfggdpsrvtlfgesagavsvslhllsalsrdlfqrailqsgsptapwalvsreeat lralrlaeavgcphepsklsdaveclrgkdphvlvnnewgtlgicefpfvpvvdgaflde tpqrslasgrfkkteiltgsnteegyyfiiyyltellrkeegvtvtreeflqavrelnpy vngaarqaivfeytdwtepdnpnsnrdaldkmvgdyhftcnvnefaqryaeegnnvymyl ythrskgnpwprwtgvmhgdeinyvfgeplnptlgytedekdfsrkimrywsnfaktgnp npntassefpewpkhtahgrhylelglntsfvgrgprlrqcafwkkylpqlvaatsn
Timeline for d6aryb_: