Lineage for d6apvd_ (6apv D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2499119Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2499120Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2499121Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2499210Protein Hypoxanthine PRTase [53286] (4 species)
  7. 2499221Species Trypanosoma brucei [TaxId:5702] [324926] (10 PDB entries)
  8. 2499233Domain d6apvd_: 6apv D: [349150]
    automated match to d1p17b_
    complexed with 3l4, mg, peg

Details for d6apvd_

PDB Entry: 6apv (more details), 1.99 Å

PDB Description: trypanosoma brucei hypoxanthine guanine phosphoribosyltransferase in complex with [(2-{[2-(2-amino-6-oxo-1,6-dihydro-9h-purin-9-yl) ethyl][(e)-2-phosphonoethenyl]amino}ethoxy)methyl]phosphonic acid
PDB Compounds: (D:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d6apvd_:

Sequence, based on SEQRES records: (download)

>d6apvd_ c.61.1.1 (D:) Hypoxanthine PRTase {Trypanosoma brucei [TaxId: 5702]}
ckydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvftadmv
rilgdfgvptrveflrassyghdtkscgrvdvkadglcdirgkhvlvledildtaltlre
vvdslkksepasiktlvaidkpggrkipftaeyvvadvpnvfvvgygldydqsyrevrdv
vilkpsvyetwgkeler

Sequence, based on observed residues (ATOM records): (download)

>d6apvd_ c.61.1.1 (D:) Hypoxanthine PRTase {Trypanosoma brucei [TaxId: 5702]}
ckydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvftadmv
rilgdfgvptrveflradirgkhvlvledildtaltlrevvdslkksepasiktlvaidk
pggrkipftaeyvvadvpnvfvvgygldydqsyrevrdvvilkpsvyetwgkeler

SCOPe Domain Coordinates for d6apvd_:

Click to download the PDB-style file with coordinates for d6apvd_.
(The format of our PDB-style files is described here.)

Timeline for d6apvd_: