Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins) automatically mapped to Pfam PF12680 automatically mapped to Pfam PF02136 |
Protein automated matches [260878] (2 species) not a true protein |
Species Mycobacterium neoaurum [TaxId:1795] [349008] (1 PDB entry) |
Domain d5z3rd_: 5z3r D: [349080] automated match to d2z7ac_ |
PDB Entry: 5z3r (more details), 2.42 Å
SCOPe Domain Sequences for d5z3rd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z3rd_ d.17.4.3 (D:) automated matches {Mycobacterium neoaurum [TaxId: 1795]} spvvaasqnswrcvqsgdregwlalmaddivvedpigeavtnpdgtgvrgkaalaafydt nigpnrlrvtceatfpssspteiayilvlettfpngfvatvrgvftyrvddaglitnlrg ywnmdamtf
Timeline for d5z3rd_: