Lineage for d5z7rb_ (5z7r B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2461873Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2461874Protein automated matches [190246] (70 species)
    not a true protein
  7. 2461935Species Clostridium acetobutylicum [TaxId:272562] [349027] (1 PDB entry)
  8. 2461937Domain d5z7rb_: 5z7r B: [349075]
    automated match to d4fzwa_

Details for d5z7rb_

PDB Entry: 5z7r (more details), 2.2 Å

PDB Description: crystal structure of crotonase from clostridium acetobutylicum
PDB Compounds: (B:) Short-chain-enoyl-CoA hydratase

SCOPe Domain Sequences for d5z7rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z7rb_ c.14.1.0 (B:) automated matches {Clostridium acetobutylicum [TaxId: 272562]}
melnnvilekegkvavvtinrpkalnalnsdtlkemdyvigeiendsevlaviltgagek
sfvagadisemkemntiegrkfgilgnkvfrrlellekpviaavngfalgggceiamscd
iriassnarfgqpevglgitpgfggtqrlsrlvgmgmakqliftaqnikadealriglvn
kvvepselmntakeiankivsnapvavklskqainrgmqcdidtalafeseafgecfste
dqkdamtafiekrk

SCOPe Domain Coordinates for d5z7rb_:

Click to download the PDB-style file with coordinates for d5z7rb_.
(The format of our PDB-style files is described here.)

Timeline for d5z7rb_: