Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.0: automated matches [191338] (1 protein) not a true family |
Protein automated matches [190215] (38 species) not a true protein |
Species Fusobacterium nucleatum [TaxId:190304] [333378] (7 PDB entries) |
Domain d5z5cc_: 5z5c C: [349072] Other proteins in same PDB: d5z5cb2 automated match to d5b53a_ complexed with cl, plp |
PDB Entry: 5z5c (more details), 2.07 Å
SCOPe Domain Sequences for d5z5cc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z5cc_ c.79.1.0 (C:) automated matches {Fusobacterium nucleatum [TaxId: 190304]} kkmkylenlvgktpmlelifdykgeerrifvknesynltgsikdrmafytlkkayeknei kkgapiveatsgntgiafsamgailghpviiympdwmseerkslirsfgakiilvsrkeg gflgsiektkefaknnpdtylpsqfsnlynseahyygigleivnemkslnlnidgfvagv gtggtvmgigkrikenfsnakicpleplnsptlstgykvakhriegisdefipdlvkldk ldnvvsvddgdaivmaqklakcglgvgissganfigalmlqnklgkdsvivtvfpddnkk ylstdlmreekvkedflskditlkeiknvlrv
Timeline for d5z5cc_:
View in 3D Domains from other chains: (mouse over for more information) d5z5ca_, d5z5cb1, d5z5cb2, d5z5cd_ |