SCOPe 2.07: Domain d5xmhb1: 5xmh B:238-339

Lineage for d5xmhb1 (5xmh B:238-339)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (17 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
Domain d5xmhb1: 5xmh B:238-339 [348946]
Other proteins in same PDB: d5xmhc_, d5xmhl1
automated match to d2j6ea1
complexed with bma, fuc, man, nag

Details for d5xmhb1

PDB Entry: 5xmh (more details), 2.8 Å

PDB Description: crystal structure of an igm rheumatoid factor yes8c in complex with igg1 fc

PDB Compounds: (B:) Immunoglobulin gamma-1 heavy chain

SCOPe Domain Sequences for d5xmhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xmhb1 b.1.1.2 (B:238-339) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqyn
styrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

SCOPe Domain Coordinates for d5xmhb1:

Click to download the PDB-style file with coordinates for d5xmhb1.
(The format of our PDB-style files is described here.)

Timeline for d5xmhb1: