Lineage for d1vdra_ (1vdr A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1384489Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1384490Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1384491Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 1384520Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species)
  7. 1384614Species Haloferax volcanii [TaxId:2246] [53604] (1 PDB entry)
  8. 1384615Domain d1vdra_: 1vdr A: [34893]
    CASP2
    complexed with po4

Details for d1vdra_

PDB Entry: 1vdr (more details), 2.55 Å

PDB Description: dihydrofolate reductase
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d1vdra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vdra_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Haloferax volcanii [TaxId: 2246]}
elvsvaalaenrvigrdgelpwpsipadkkqyrsriaddpvvlgrttfesmrddlpgsaq
ivmsrsersfsvdtahraasveeavdiaasldaetayviggaaiyalfqphldrmvlsrv
pgeyegdtyypewdaaeweldaetdhegftlqewvrs

SCOPe Domain Coordinates for d1vdra_:

Click to download the PDB-style file with coordinates for d1vdra_.
(The format of our PDB-style files is described here.)

Timeline for d1vdra_: