Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species) |
Species Haloferax volcanii [TaxId:2246] [53604] (1 PDB entry) |
Domain d1vdra_: 1vdr A: [34893] CASP2 complexed with po4 |
PDB Entry: 1vdr (more details), 2.55 Å
SCOPe Domain Sequences for d1vdra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vdra_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Haloferax volcanii [TaxId: 2246]} elvsvaalaenrvigrdgelpwpsipadkkqyrsriaddpvvlgrttfesmrddlpgsaq ivmsrsersfsvdtahraasveeavdiaasldaetayviggaaiyalfqphldrmvlsrv pgeyegdtyypewdaaeweldaetdhegftlqewvrs
Timeline for d1vdra_: