SCOPe 2.07: Domain d5yoba1: 5yob A:3-148

Lineage for d5yoba1 (5yob A:3-148)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
   binds FMN

6. Protein automated matches [190443] (7 species)
   not a true protein

7. Species Desulfovibrio vulgaris [TaxId:882] [348888] (4 PDB entries)

8. Domain d5yoba1: 5yob A:3-148 [348906]
   Other proteins in same PDB: d5yoba2
   automated match to d1j8qa_
   complexed with fmn, gol

Details for d5yoba1

PDB Entry: 5yob, 1.14 Å

PDB Description: crystal structure of flavodoxin without engineered disulfide bond

PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d5yoba1:

Sequence; same for both SEQRES and ATOM records:

>d5yoba1 c.23.5.1 (A:3-148) automated matches {Desulfovibrio vulgaris [TaxId: 882]}
kalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwgd
dsielqddfiplfdsleetgaqgrkvacfgcgdssweyfcgavdaieeklknlgaeivqd
glridgdpraarddivgwahdvrgai

Timeline for d5yoba1:

• d5yoba1 is new in SCOPe 2.07-stable
  
• d5yoba1 appears in the current release, SCOPe 2.08