Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.1: Flavodoxin-related [52219] (6 proteins) binds FMN |
Protein automated matches [190443] (7 species) not a true protein |
Species Desulfovibrio vulgaris [TaxId:882] [348888] (4 PDB entries) |
Domain d5yoba1: 5yob A:3-148 [348906] Other proteins in same PDB: d5yoba2 automated match to d1j8qa_ complexed with fmn, gol |
PDB Entry: 5yob (more details), 1.14 Å
SCOPe Domain Sequences for d5yoba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yoba1 c.23.5.1 (A:3-148) automated matches {Desulfovibrio vulgaris [TaxId: 882]} kalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwgd dsielqddfiplfdsleetgaqgrkvacfgcgdssweyfcgavdaieeklknlgaeivqd glridgdpraarddivgwahdvrgai
Timeline for d5yoba1: