Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (158 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [348799] (4 PDB entries) |
Domain d5yh8a1: 5yh8 A:1-507 [348830] Other proteins in same PDB: d5yh8a2 automated match to d4oera_ complexed with 8ux, gol, ni, peg |
PDB Entry: 5yh8 (more details), 2.12 Å
SCOPe Domain Sequences for d5yh8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yh8a1 c.94.1.0 (A:1-507) automated matches {Staphylococcus aureus [TaxId: 1280]} gleekkenkqltyttvkdigdmnphvyggsmsaesmiyeplvrntkdgikpllakkwdvs edgktytfhlrddvkfhdgtpfdadavkknidavqenkklhswlkistlidnvkvkdkyt velnlkeayqpalaelamprpyvfvspkdfkngttkdgvkkfdgtgpfklgehkkdesad fnkndqywgeksklnkvqakvmpagetaflsmkkgetnfaftddrgtdsldkdslkqlkd tgdyqvkrsqpmntkmlvvnsgkkdnavsdktvrqaighmvnrdkiakeildgqekpatq lfaknvtdinfdmptrkydlkkaeslldeagwkkgkdsdvrqkdgknlemamyydkgsss qkeqaeylqaefkkmgiklningetsdkiaerrtsgdydlmfnqtwgllydpqstiaafk akngyesatsgienkdkiynsiddafkiqngkersdayknilkqiddegifipishgsmt vvapkdlekvsftqsqyelpfnemqyk
Timeline for d5yh8a1: