Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (71 species) not a true protein |
Species Oreochromis mossambicus [TaxId:8127] [348768] (1 PDB entry) |
Domain d5y7ia2: 5y7i A:98-242 [348769] Other proteins in same PDB: d5y7ia1, d5y7ib1 automated match to d2pera2 |
PDB Entry: 5y7i (more details), 3 Å
SCOPe Domain Sequences for d5y7ia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5y7ia2 a.45.1.0 (A:98-242) automated matches {Oreochromis mossambicus [TaxId: 8127]} ryphlspvnkesfdvgadifakfsafiknspnnplqeknllrefkrlddylnsplpeeid hnsvetitvsnrkfldgdrltladcnllpklhvirvaakkycnfeipdhftgvwrylkna derdefkqtcpadieiekaylsvan
Timeline for d5y7ia2: