Lineage for d5o7qa_ (5o7q A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2542784Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2542785Family d.17.1.1: Monellin [54404] (2 proteins)
  6. 2542808Protein automated matches [190339] (1 species)
    not a true protein
  7. 2542809Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [187163] (12 PDB entries)
  8. 2542815Domain d5o7qa_: 5o7q A: [348747]
    automated match to d1iv7a_
    complexed with peg, so4; mutant

Details for d5o7qa_

PDB Entry: 5o7q (more details), 1.72 Å

PDB Description: crystal structure of a single chain monellin mutant (y65r) ph 5.5
PDB Compounds: (A:) Monellin chain B,Monellin chain A

SCOPe Domain Sequences for d5o7qa_:

Sequence, based on SEQRES records: (download)

>d5o7qa_ d.17.1.1 (A:) automated matches {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyenegfreikgyey
qlyvrasdklfradisedyktrgrkllrfngpvppp

Sequence, based on observed residues (ATOM records): (download)

>d5o7qa_ d.17.1.1 (A:) automated matches {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyeikgyeyqlyvra
sdklfradisedyktrgrkllrfngpvppp

SCOPe Domain Coordinates for d5o7qa_:

Click to download the PDB-style file with coordinates for d5o7qa_.
(The format of our PDB-style files is described here.)

Timeline for d5o7qa_: