Lineage for d5x6fc_ (5x6f C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2468637Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2468823Protein automated matches [190964] (7 species)
    not a true protein
  7. 2468871Species Pseudomonas aeruginosa [TaxId:208964] [348384] (1 PDB entry)
  8. 2468874Domain d5x6fc_: 5x6f C: [348716]
    automated match to d4rukb_
    complexed with gol, ipa

Details for d5x6fc_

PDB Entry: 5x6f (more details), 2.59 Å

PDB Description: crystal structure of phosphopantetheine adenylyltransferase from pseudomonas aeruginosa
PDB Compounds: (C:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d5x6fc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x6fc_ c.26.1.3 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
mnrvlypgtfdpitkghgdlierasrlfdhviiavaaspkknplfsleqrvalaqevtkh
lpnvevvgfstllahfvkeqkanvflrglravsdfeyefqlanmnrqlapdvesmfltps
ekysfisstlvreiaalggdiskfvhpavadalaerfk

SCOPe Domain Coordinates for d5x6fc_:

Click to download the PDB-style file with coordinates for d5x6fc_.
(The format of our PDB-style files is described here.)

Timeline for d5x6fc_: