Lineage for d5xg8a_ (5xg8 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390272Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2390273Protein automated matches [190437] (66 species)
    not a true protein
  7. 2390546Species Human (Homo sapiens) [TaxId:9606] [187655] (107 PDB entries)
  8. 2390594Domain d5xg8a_: 5xg8 A: [348699]
    automated match to d1g86a_
    complexed with gol

Details for d5xg8a_

PDB Entry: 5xg8 (more details), 1.55 Å

PDB Description: galectin-13/placental protein 13 variant r53h crystal structure
PDB Compounds: (A:) Galactoside-binding soluble lectin 13

SCOPe Domain Sequences for d5xg8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xg8a_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sslpvpyklpvslsvgscviikgtpihsfindpqlqvdfytdmdedsdiafhfrvhfgnh
vvmnrrefgiwmleettdyvpfedgkqfelciyvhyneyeikvngiriygfvhrippsfv
kmvqvsrdisltsvcvcn

SCOPe Domain Coordinates for d5xg8a_:

Click to download the PDB-style file with coordinates for d5xg8a_.
(The format of our PDB-style files is described here.)

Timeline for d5xg8a_: