Lineage for d5x2bk_ (5x2b K:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872531Species Mouse (Mus musculus) [TaxId:10090] [186847] (24 PDB entries)
  8. 2872554Domain d5x2bk_: 5x2b K: [348542]
    Other proteins in same PDB: d5x2bc2, d5x2bd2, d5x2bf2, d5x2bh2, d5x2bl2, d5x2bl3
    automated match to d1j99a_
    complexed with a3p, ca, gol

Details for d5x2bk_

PDB Entry: 5x2b (more details), 2.08 Å

PDB Description: crystal structure of mouse sulfotransferase sult7a1 complexed with pap
PDB Compounds: (K:) sulfotransferase

SCOPe Domain Sequences for d5x2bk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x2bk_ c.37.1.0 (K:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
psllhkymgiffstmsseellgsldsfdareddiflvsypksgthwlaevieripdagit
ltspielgdiskfeelkripkrraipthlnyemlpvtvkqkqckiiyivrnpkdtavsmf
hyyrdnpnlpstetwaaflelflkgdvvygswfdhvlsweehkndknvlfifyeemkkdf
vkslkkitaflgidvndsemakiarstsfsemksnaakencdpnhvicaltsdrnlvfrk
gvvgdwinyftpkqnrgfdelftekmrnsdvgrclkeyahs

SCOPe Domain Coordinates for d5x2bk_:

Click to download the PDB-style file with coordinates for d5x2bk_.
(The format of our PDB-style files is described here.)

Timeline for d5x2bk_: