Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186847] (24 PDB entries) |
Domain d5x2bk_: 5x2b K: [348542] Other proteins in same PDB: d5x2bc2, d5x2bd2, d5x2bf2, d5x2bh2, d5x2bl2, d5x2bl3 automated match to d1j99a_ complexed with a3p, ca, gol |
PDB Entry: 5x2b (more details), 2.08 Å
SCOPe Domain Sequences for d5x2bk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x2bk_ c.37.1.0 (K:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} psllhkymgiffstmsseellgsldsfdareddiflvsypksgthwlaevieripdagit ltspielgdiskfeelkripkrraipthlnyemlpvtvkqkqckiiyivrnpkdtavsmf hyyrdnpnlpstetwaaflelflkgdvvygswfdhvlsweehkndknvlfifyeemkkdf vkslkkitaflgidvndsemakiarstsfsemksnaakencdpnhvicaltsdrnlvfrk gvvgdwinyftpkqnrgfdelftekmrnsdvgrclkeyahs
Timeline for d5x2bk_: