SCOPe 2.07: Domain d5wyda_: 5wyd A:

Lineage for d5wyda_ (5wyd A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (70 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [348264] (5 PDB entries)

8. Domain d5wyda_: 5wyd A: [348479]
   automated match to d2ppya_
   complexed with ipa, mpd, mrd, ptd

Details for d5wyda_

PDB Entry: 5wyd, 2.1 Å

PDB Description: structural of pseudomonas aeruginosa dspi

PDB Compounds: (A:) Probable enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d5wyda_:

Sequence; same for both SEQRES and ATOM records:

>d5wyda_ c.14.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
kassfddthkltvekhghtalitinhppantwdrdsliglrqliehlnrdddiyalvvtg
qgpkffsagadlnmfadgdkararemarrfgeafealrdfrgvsiaaingyamgggleca
lacdiriaerqaqmalpeaavgllpcaggtqalpwlvgegwakrmilcnervdaetalri
glveqvvdsgeargaalllaakvarqspvairtikpliqgarerapntwlpeererfvdl
fdaqdtregvnaflekrdpkwr

Timeline for d5wyda_:

• d5wyda_ is new in SCOPe 2.07-stable
  
• d5wyda_ appears in the current release, SCOPe 2.08