Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (156 species) not a true protein |
Species Thermus thermophilus [TaxId:300852] [272710] (20 PDB entries) |
Domain d5x8ka_: 5x8k A: [348374] automated match to d3n2ia_ complexed with cl, na; mutant |
PDB Entry: 5x8k (more details), 1.67 Å
SCOPe Domain Sequences for d5x8ka_:
Sequence, based on SEQRES records: (download)
>d5x8ka_ c.37.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 300852]} pglfltlegldgsgkttqarrlaafleaqgrpvlltrepggglpevrsllltqelspeae yllfsadraehvrkvilpglaagkvvisdryldsslayqgygrglplpwlrevareatrg lkprltflldlppeaalrrvrrpdrleglgleffrrtregylalaraepgrfvvldatlp eeeiaraiqahlrpll
>d5x8ka_ c.37.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 300852]} pglfltlegldgsgkttqarrlaafleaqgrpvlltrepggglpevrsllltqelspeae yllfsadraehvrkvilpglaagkvvisdryldsslayqgygrglplpwlrevareatrg lkprltflldlppeaaglgleffrrtregylalaraepgrfvvldatlpeeeiaraiqah lrpll
Timeline for d5x8ka_: