Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
Protein automated matches [190384] (21 species) not a true protein |
Species Rhinovirus c [TaxId:463676] [255484] (2 PDB entries) |
Domain d5x45c_: 5x45 C: [348372] automated match to d2m5ta_ complexed with zn |
PDB Entry: 5x45 (more details), 2.6 Å
SCOPe Domain Sequences for d5x45c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x45c_ b.47.1.4 (C:) automated matches {Rhinovirus c [TaxId: 463676]} gpsdmfvhtrdaiykcahltnptdetillaltadlqvdstnvpgpdvipccdctagcyys rskdryfpvecvshdwyeiqesgyypkhiqynlligeghcepgdcggkllckhgvigmit aggdnhvaftdlrpyss
Timeline for d5x45c_: