SCOPe 2.07: Domain d5wuwa_: 5wuw A:

Lineage for d5wuwa_ (5wuw A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Serratia marcescens [TaxId:615] [348247] (5 PDB entries)

8. Domain d5wuwa_: 5wuw A: [348339]
   automated match to d4za2a_
   complexed with nap; mutant

Details for d5wuwa_

PDB Entry: 5wuw, 1.9 Å

PDB Description: serratia marcescens short-chain dehydrogenase/reductase f98l/f202l mutant

PDB Compounds: (A:) Short-chain dehydrogenase

SCOPe Domain Sequences for d5wuwa_:

Sequence; same for both SEQRES and ATOM records:

>d5wuwa_ c.2.1.0 (A:) automated matches {Serratia marcescens [TaxId: 615]}
hplqgkvafvqggsrgigaaivkrlasegaavaftyaasadraeavasavttaggkvlai
kadsadaaalqqavrqavshfgnldilvnnagvltlggteelalddldrmlavnvrsvfv
asqeaarhmndggriihigstnaervpfggaavyamsksalvgltkgmardlgprsitvn
nvqpgpvdtemnpdageladqlkqlmaigrygkdeeiagfvaylagpqagyitgaslsid
ggfsa

Timeline for d5wuwa_:

• d5wuwa_ is new in SCOPe 2.07-stable
  
• d5wuwa_ appears in the current release, SCOPe 2.08