Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (70 species) not a true protein |
Species Acinetobacter sp. [TaxId:1182652] [348104] (3 PDB entries) |
Domain d5wibb_: 5wib B: [348325] automated match to d4x55a_ complexed with id1 |
PDB Entry: 5wib (more details), 1.87 Å
SCOPe Domain Sequences for d5wibb_:
Sequence, based on SEQRES records: (download)
>d5wibb_ e.3.1.0 (B:) automated matches {Acinetobacter sp. [TaxId: 1182652]} sqivqghnqvihqyfdekntsgvlviqtdkkinlygnalsranteyvpastfdmlnalig lenqktdineifkwkgekrlftawekdmtlgeamklsavpvyqelarrigldlmqkevkr igfgnaeigqqvdnfwlvgplkvtpiqevefvsqlahtqlpfsekvqanvknmllleesn gykifgktgwamniksqvgwltgwveqpdgkivafalnmemrsempasirnellmkslkq lnii
>d5wibb_ e.3.1.0 (B:) automated matches {Acinetobacter sp. [TaxId: 1182652]} sqivqghnqvihqyfdekntsgvlviqtdkkinlygnalsranteyvpastfdmlnalig lenqktdineifrlftawekdmtlgeamklsavpvyqelarrigldlmqkevkrigfgna eigqqvdnfwlvgplkvtpiqevefvsqlahtqlpfsekvqanvknmllleesngykifg ktgwamniksqvgwltgwveqpdgkivafalnmemrsempasirnellmkslkqlnii
Timeline for d5wibb_: