Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) |
Family c.52.1.34: PA N-terminal domain [254166] (2 proteins) Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458 |
Protein PA N-terminal domain [254375] (7 species) |
Species Influenza A virus [TaxId:93838] [254808] (91 PDB entries) |
Domain d5wf3a1: 5wf3 A:1-195 [348164] Other proteins in same PDB: d5wf3a2 automated match to d4e5ed_ complexed with ku2, mn, so4; mutant |
PDB Entry: 5wf3 (more details), 2.25 Å
SCOPe Domain Sequences for d5wf3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wf3a1 c.52.1.34 (A:1-195) PA N-terminal domain {Influenza A virus [TaxId: 93838]} medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii egrdrimawtvvnsicnttgvekpkflpdlydykenrfidigvtrrevhiyylekankik sekthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqse
Timeline for d5wf3a1: