Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (7 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries) Uniprot P01887 |
Domain d5vcjb_: 5vcj B: [348072] Other proteins in same PDB: d5vcja1, d5vcja2, d5vcjc1, d5vcjc2, d5vcjd1, d5vcjd2 automated match to d3gmob_ complexed with bma, fuc, man, nag, pbs, plm |
PDB Entry: 5vcj (more details), 3.16 Å
SCOPe Domain Sequences for d5vcjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vcjb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} qktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdws fyilahteftptetdtyacrvkhasmaepktvywdrdm
Timeline for d5vcjb_: