SCOP 1.75: Domain d1dwob_: 1dwo B:

Lineage for d1dwob_ (1dwo B:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.20: Hydroxynitrile lyase-like [53585] (2 proteins)

6. Protein Hydroxynitrile lyase [53586] (2 species)

7. Species Cassava (Manihot esculenta) [TaxId:3983] [53588] (7 PDB entries)

8. Domain d1dwob_: 1dwo B: [34805]
   complexed with acn

Details for d1dwob_

PDB Entry: 1dwo, 2.2 Å

PDB Description: crystal structure of hydroxynitrile lyase from manihot esculenta in complex with substrates acetone and chloroacetone:implications for the mechanism of cyanogenesis

PDB Compounds: (B:) hydroxynitrile lyase

SCOP Domain Sequences for d1dwob_:

Sequence; same for both SEQRES and ATOM records:

>d1dwob_ c.69.1.20 (B:) Hydroxynitrile lyase {Cassava (Manihot esculenta) [TaxId: 3983]}
mvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfdeysep
lltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsytvek
llesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrkgslf
qnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdhklql
tkteevahilqevadaya

Timeline for d1dwob_:

• d1dwob_ first appeared (with stable ids) in SCOP 1.55
  
• d1dwob_ appears in SCOP 1.73
  
• d1dwob_ appears in SCOPe 2.01
  
• d1dwob_ appears in the current release, SCOPe 2.08, called d1dwob1