Lineage for d1dwoa_ (1dwo A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 841866Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 841867Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 842582Family c.69.1.20: Hydroxynitrile lyase-like [53585] (2 proteins)
  6. 842583Protein Hydroxynitrile lyase [53586] (2 species)
  7. 842584Species Cassava (Manihot esculenta) [TaxId:3983] [53588] (7 PDB entries)
  8. 842593Domain d1dwoa_: 1dwo A: [34804]

Details for d1dwoa_

PDB Entry: 1dwo (more details), 2.2 Å

PDB Description: crystal structure of hydroxynitrile lyase from manihot esculenta in complex with substrates acetone and chloroacetone:implications for the mechanism of cyanogenesis
PDB Compounds: (A:) hydroxynitrile lyase

SCOP Domain Sequences for d1dwoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dwoa_ c.69.1.20 (A:) Hydroxynitrile lyase {Cassava (Manihot esculenta) [TaxId: 3983]}
piskmvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfde
yseplltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsy
tvekllesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrk
gslfqnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdh
klqltkteevahilqevadaya

SCOP Domain Coordinates for d1dwoa_:

Click to download the PDB-style file with coordinates for d1dwoa_.
(The format of our PDB-style files is described here.)

Timeline for d1dwoa_: