Class a: All alpha proteins [46456] (289 folds) |
Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.103.1: Citrate synthase [48256] (2 families) |
Family a.103.1.1: Citrate synthase [48257] (2 proteins) duplication: large domain consists of two structural repeats the second repeat is interrupted by the small domain automatically mapped to Pfam PF00285 |
Protein automated matches [190675] (10 species) not a true protein |
Species Homo sapiens [TaxId:9606] [347927] (3 PDB entries) |
Domain d5uzra_: 5uzr A: [348029] automated match to d3enja_ complexed with cl |
PDB Entry: 5uzr (more details), 2.3 Å
SCOPe Domain Sequences for d5uzra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uzra_ a.103.1.1 (A:) automated matches {Homo sapiens [TaxId: 9606]} stnlkdiladlipkeqariktfrqqhgktvvgqitvdmmyggmrgmkglvyetsvldpde girfrgfsipecqkllpkakggeeplpeglfwllvtghipteeqvswlskewakraalps hvvtmldnfptnlhpmsqlsaavtalnsesnfarayaqgisrtkyweliyedsmdliakl pcvaakiyrnlyregsgigaidsnldwshnftnmlgytdhqfteltrlyltihsdheggn vsahtshlvgsalsdpylsfaaamnglagplhglanqevlvwltqlqkevgkdvsdeklr dyiwntlnsgrvvpgyghavlrktdprytcqrefalkhlpndpmfklvaqlykivpnvll eqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfplerp ksmsteglmkfvds
Timeline for d5uzra_: