SCOPe 2.07: Domain d5vbra1: 5vbr A:29-136

Lineage for d5vbra1 (5vbr A:29-136)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries)

8. Domain d5vbra1: 5vbr A:29-136 [347969]
   Other proteins in same PDB: d5vbra2, d5vbrb2
   automated match to d2nxba_
   complexed with cl, edo, ibi

Details for d5vbra1

PDB Entry: 5vbr, 1.9 Å

PDB Description: crystal structure of the first bromodomain of human brdt in complex with volasertib

PDB Compounds: (A:) Bromodomain testis-specific protein

SCOPe Domain Sequences for d5vbra1:

Sequence; same for both SEQRES and ATOM records:

>d5vbra1 a.29.2.0 (A:29-136) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tnqlqylqkvvlkdlwkhsfswpfqrpvdavklqlpdyytiiknpmdlntikkrlenkyy
akaseciedfntmfsncylynkpgddivlmaqaleklfmqklsqmpqe

Timeline for d5vbra1:

• d5vbra1 is new in SCOPe 2.07-stable
  
• d5vbra1 appears in the current release, SCOPe 2.08