SCOPe 2.07: Domain d5ucia1: 5uci A:1-217

Lineage for d5ucia1 (5uci A:1-217)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein automated matches [190229] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187292] (156 PDB entries)

8. Domain d5ucia1: 5uci A:1-217 [347939]
   Other proteins in same PDB: d5ucia2, d5ucic2
   automated match to d1uyma_
   complexed with 874, dms, gol

Details for d5ucia1

PDB Entry: 5uci, 2.7 Å

PDB Description: hsp90b n-terminal domain with inhibitors

PDB Compounds: (A:) heat shock protein hsp 90-beta

SCOPe Domain Sequences for d5ucia1:

Sequence; same for both SEQRES and ATOM records:

>d5ucia1 d.122.1.1 (A:1-217) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpeevhhgeeevetfafqaeiaqlmsliintfysnkeiflrelisnasdaldkiryeslt
dpskldsgkelkidiipnpqertltlvdtgigmtkadlinnlgtiaksgtkafmealqag
adismigqfgvgfysaylvaekvvvitkhnddeqyawessaggsftvradhgepigrgtk
vilhlkedqteyleerrvkevvkkhsqfigypitlyl

Timeline for d5ucia1:

• d5ucia1 is new in SCOPe 2.07-stable
  
• d5ucia1 appears in the current release, SCOPe 2.08