Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
Protein automated matches [190158] (30 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [255999] (16 PDB entries) |
Domain d5urga1: 5urg A:62-237 [347924] Other proteins in same PDB: d5urga2, d5urga3, d5urgb2, d5urgb3 automated match to d1ja1a2 complexed with fad, fmn, nap, po4; mutant |
PDB Entry: 5urg (more details), 2.3 Å
SCOPe Domain Sequences for d5urga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5urga1 c.23.5.0 (A:62-237) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} ppvkessfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydlad lsslpeidkslvvfcmatygegdptdnaqdfydwlqetdvdltgvkfavfglgnktyehf namgkyvdqrleqlgaqrifelglgdddgnleedfitwreqfwpavceffgveatg
Timeline for d5urga1: