Lineage for d5urga1 (5urg A:62-237)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2464623Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2465166Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2465167Protein automated matches [190158] (30 species)
    not a true protein
  7. 2465315Species Norway rat (Rattus norvegicus) [TaxId:10116] [255999] (16 PDB entries)
  8. 2465334Domain d5urga1: 5urg A:62-237 [347924]
    Other proteins in same PDB: d5urga2, d5urga3, d5urgb2, d5urgb3
    automated match to d1ja1a2
    complexed with fad, fmn, nap, po4; mutant

Details for d5urga1

PDB Entry: 5urg (more details), 2.3 Å

PDB Description: rat cypor d632f mutant
PDB Compounds: (A:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d5urga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5urga1 c.23.5.0 (A:62-237) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ppvkessfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydlad
lsslpeidkslvvfcmatygegdptdnaqdfydwlqetdvdltgvkfavfglgnktyehf
namgkyvdqrleqlgaqrifelglgdddgnleedfitwreqfwpavceffgveatg

SCOPe Domain Coordinates for d5urga1:

Click to download the PDB-style file with coordinates for d5urga1.
(The format of our PDB-style files is described here.)

Timeline for d5urga1: