SCOPe 2.07: Domain d5uhta2: 5uht A:321-480

Lineage for d5uhta2 (5uht A:321-480)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.3: Histidine kinase [55884] (8 proteins)

6. Protein automated matches [190839] (4 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [227717] (7 PDB entries)

8. Domain d5uhta2: 5uht A:321-480 [347910]
   Other proteins in same PDB: d5uhta1, d5uhtb_, d5uhtc1, d5uhtd_
   automated match to d2c2aa2
   complexed with adp, gol, mg, so4

Details for d5uhta2

PDB Entry: 5uht, 2.68 Å

PDB Description: structure of the thermotoga maritima hk853-bef3-rr468 complex at ph 5.0

PDB Compounds: (A:) sensor histidine kinase

SCOPe Domain Sequences for d5uhta2:

Sequence; same for both SEQRES and ATOM records:

>d5uhta2 d.122.1.3 (A:321-480) automated matches {Thermotoga maritima [TaxId: 243274]}
qinrekvdlcdlvesavnaikefasshnvnvlfesnvpcpveayidptrirqvllnllnn
gvkyskkdapdkyvkvildekdggvliivedngigipdhakdrifeqfyrvdssltyevp
gtglglaitkeivelhggriwvesevgkgsrffvwipkdr

Timeline for d5uhta2:

• d5uhta2 is new in SCOPe 2.07-stable
  
• d5uhta2 appears in the current release, SCOPe 2.08