Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) contains a common phosphate-binding site |
Family c.24.1.0: automated matches [347767] (1 protein) not a true family |
Protein automated matches [347768] (3 species) not a true protein |
Species Homo sapiens [TaxId:9606] [347769] (2 PDB entries) |
Domain d5uy8b1: 5uy8 B:4-200 [347843] Other proteins in same PDB: d5uy8a2, d5uy8b2, d5uy8c2, d5uy8d2 automated match to d1pkxb1 complexed with 8um, amz, mg |
PDB Entry: 5uy8 (more details), 2.39 Å
SCOPe Domain Sequences for d5uy8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uy8b1 c.24.1.0 (B:4-200) automated matches {Homo sapiens [TaxId: 9606]} gqlalfsvsdktglvefarnltalglnlvasggtakalrdaglavrdvseltgfpemlgg rvktlhpavhagilarnipednadmarldfnlirvvacnlypfvktvaspgvtveeaveq idiggvtllraaaknharvtvvcepedyvvvstemqsseskdtsletrrqlalkafthta qydeaisdyfrkqyskg
Timeline for d5uy8b1: