SCOPe 2.07: Domain d5upla_: 5upl A:

Lineage for d5upla_ (5upl A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (35 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1319 PDB entries)

8. Domain d5upla_: 5upl A: [347764]
   Other proteins in same PDB: d5uplb_
   automated match to d2q0na_

Details for d5upla_

PDB Entry: 5upl, 3 Å

PDB Description: cdc42 binds pak4 via an extended gtpase-effector inteface - 2 peptide: pak4fl, cdc42 - unrefined

PDB Compounds: (A:) serine/threonine-protein kinase pak 4

SCOPe Domain Sequences for d5upla_:

Sequence; same for both SEQRES and ATOM records:

>d5upla_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsheqfraalqlvvdpgdprsyldnfikigegstgivciatvrssgklvavkkmdlrkqq
rrellfnevvimrdyqhenvvemynsylvgdelwvvmefleggaltdivthtrmneeqia
avclavlqalsvlhaqgvihrdiksdsillthdgrvklsdfgfcaqvskevprrkslvgt
pywmapelisrlpygpevdiwslgimviemvdgeppyfnepplkamkmirdnlpprlknl
hkvspslkgfldrllvrdpaqrataaellkhpflakagppasivplmrqnr

Timeline for d5upla_:

• d5upla_ is new in SCOPe 2.07-stable
  
• d5upla_ appears in the current release, SCOPe 2.08